PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1125
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family YABBY
Protein Properties Length: 183aa    MW: 20436.9 Da    PI: 8.2201
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1125genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY225.71.2e-6921572170
        YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                  +++ +se+v yv+CnfCntilavsvP +s f++vtvrCGhC++llsvn+ ++ q++++++         ++++   +e++ ++   ++ s+ ++ s+ 
  Gh_D07G1125   2 SMDLTSERVWYVHCNFCNTILAVSVPCNSAFNIVTVRCGHCANLLSVNMGTSLQTVPSQDA--------QKQQITIDEDHSNKECGSS-SKCNKFSA- 89 
                  66789*****************************************************996........3333333333333222222.22222222. PP

        YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     +++++e++r+pp irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Gh_D07G1125  90 --VDSTEQEATRMPP-IRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 157
                  ..3567788999999.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.9E-736157IPR006780YABBY protein
SuperFamilySSF470951.7E-8101150IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.6E-5105151IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MSMDLTSERV WYVHCNFCNT ILAVSVPCNS AFNIVTVRCG HCANLLSVNM GTSLQTVPSQ  60
DAQKQQITID EDHSNKECGS SSKCNKFSAV DSTEQEATRM PPIRPPEKRQ RVPSAYNRFI  120
KEEIQRIKAS NPDISHREAF STAAKNWAHF PHIHFGLKLD GSKQAKLDQG YADQGSQKSN  180
GYC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.234980.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012477546.11e-138PREDICTED: putative axial regulator YABBY 2
SwissprotQ9XFB09e-81YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A0D2PQJ91e-138A0A0D2PQJ9_G
STRINGVIT_06s0009g00880.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55812749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.15e-82YABBY family protein